LL-37 5mg

$35.00

In stock (can be backordered)

Buy 5 Get 1 FREE!
Add $75.00 more to unlock FREE SHIPPING

SSL Secured

Secure Checkout

Guaranteed Delivery

Third-Party Tested

Buy LL-37 5mg—Human Cathelicidin Research Peptide

LL-37 is the only known human cathelicidin-derived antimicrobial peptide—produced by cleavage of the hCAP-18 precursor protein by serine proteases in neutrophil granules and epithelial cells. As the sole cathelicidin in humans (rodents express multiple cathelicidins), LL-37 occupies a unique position in the human innate immune system. It bridges innate and adaptive immunity through multiple mechanisms and has been identified in research involving wound healing, antimicrobial defense, and inflammatory modulation.

LL-37 is available in 5mg lyophilized format, independently tested to greater than 99% purity. All products are for laboratory research use only.

Classification & Research Mechanisms

Innate immune signaling: Chemokine and cytokine production stimulation, leukocyte recruitment
Antimicrobial mechanism: Membrane disruption through amphipathic alpha-helical structure
Anti-inflammatory activity: Suppresses endotoxin-induced pro-inflammatory cytokines through TLR pathway modulation
Wound healing: Angiogenic properties studied in wound closure research models
TLR modulation: Interactions with TLR2, TLR4, TLR9—dual pro/anti-inflammatory modulator depending on context

Research Applications

Innate immune signaling pathway research
Antimicrobial mechanism of action studies (membrane disruption models)
TLR pathway modulation research (TLR2, TLR4, TLR9 interactions)
Angiogenic wound healing signaling research
Cathelicidin biology and comparative species research
Inflammatory cytokine modulation studies

Product Specifications

Compound LL-37 (hCAP18 C-terminal peptide)
Full Name Human Cathelicidin Antimicrobial Peptide CAMP - LL-37 fragment
Sequence [LL-37, 37 aa] (37 amino acids)
Type Synthetic 37-amino acid cathelicidin-derived peptide
CAS Number 154947-66-7
Molecular Formula C205H340N60O53
Molecular Weight 4,493.33 g/mol
Form Lyophilized powder
Purity >99% HPLC Verified - Batch COA Available
Available Size 5mg
Storage Lyophilized: -20°C | Reconstituted: 2-8°C, use within 28 days
Reconstitution Bacteriostatic Water (BAC Water)
Intended Use Research Use Only (RUO)

Frequently Ask Questions

What does LL-37 stand for?
LL-37 takes its name from its structural characteristics: it begins with two leucine (L) residues and has 37 amino acids total. It is the C-terminal cleavage product of the hCAP-18 (human cationic antimicrobial protein, 18 kDa) precursor. hCAP-18 is encoded by the CAMP gene and is stored in neutrophil granules; cleavage by serine proteases generates the active LL-37 peptide.
Is LL-37 approved for human use?
No. LL-37 is sold strictly for laboratory and controlled scientific research purposes only (RUO). Not approved for human or veterinary use.

Related Products

From

$30.00