LL-37 5mg
$35.00
In stock (can be backordered)
Buy 5 Get 1 FREE!
Add $125.00 more to unlock FREE SHIPPING
SSL Secured
Secure Checkout
Guaranteed Delivery
Third-Party Tested
Buy LL-37 5mg—Human Cathelicidin Research Peptide
LL-37 is the only known human cathelicidin-derived antimicrobial peptide—produced by cleavage of the hCAP-18 precursor protein by serine proteases in neutrophil granules and epithelial cells. As the sole cathelicidin in humans (rodents express multiple cathelicidins), LL-37 occupies a unique position in the human innate immune system. It bridges innate and adaptive immunity through multiple mechanisms and has been identified in research involving wound healing, antimicrobial defense, and inflammatory modulation.
LL-37 is available in 5mg lyophilized format, independently tested to greater than 99% purity. All products are for laboratory research use only.
Classification & Research Mechanisms
Innate immune signaling: Chemokine and cytokine production stimulation, leukocyte recruitment
Antimicrobial mechanism: Membrane disruption through amphipathic alpha-helical structure
Anti-inflammatory activity: Suppresses endotoxin-induced pro-inflammatory cytokines through TLR pathway modulation
Wound healing: Angiogenic properties studied in wound closure research models
TLR modulation: Interactions with TLR2, TLR4, TLR9—dual pro/anti-inflammatory modulator depending on context
Research Applications
Innate immune signaling pathway research
Antimicrobial mechanism of action studies (membrane disruption models)
TLR pathway modulation research (TLR2, TLR4, TLR9 interactions)
Angiogenic wound healing signaling research
Cathelicidin biology and comparative species research
Inflammatory cytokine modulation studies
Product Specifications
| Compound | LL-37 (hCAP18 C-terminal peptide) |
| Full Name | Human Cathelicidin Antimicrobial Peptide CAMP - LL-37 fragment |
| Sequence | [LL-37, 37 aa] (37 amino acids) |
| Type | Synthetic 37-amino acid cathelicidin-derived peptide |
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4,493.33 g/mol |
| Form | Lyophilized powder |
| Purity | >99% HPLC Verified - Batch COA Available |
| Available Size | 5mg |
| Storage | Lyophilized: -20°C | Reconstituted: 2-8°C, use within 28 days |
| Reconstitution | Bacteriostatic Water (BAC Water) |
| Intended Use | Research Use Only (RUO) |
Frequently Ask Questions
What does LL-37 stand for?
LL-37 takes its name from its structural characteristics: it begins with two leucine (L) residues and has 37 amino acids total. It is the C-terminal cleavage product of the hCAP-18 (human cationic antimicrobial protein, 18 kDa) precursor. hCAP-18 is encoded by the CAMP gene and is stored in neutrophil granules; cleavage by serine proteases generates the active LL-37 peptide.
Is LL-37 approved for human use?
No. LL-37 is sold strictly for laboratory and controlled scientific research purposes only (RUO). Not approved for human or veterinary use.



